PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2AS_0186B9E4F.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 421aa    MW: 46000.9 Da    PI: 6.9107
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2AS_0186B9E4F.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY85.54.7e-27152207259
                            --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            dDgynWrKYGqK vkg ++p+sYY+Ct  +Cpv+k+ve+sa d+++++i+Y+g+H he
  Traes_2AS_0186B9E4F.2 152 DDGYNWRKYGQKAVKGGKYPKSYYKCTL-NCPVRKNVEHSA-DGRIIKIIYRGQHCHE 207
                            8*************************97.7***********.***************7 PP

2WRKY102.42.5e-32315373159
                            ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            ldDgy+WrKYGqK+v+g+++prsYY+Ct++gC vkk++ers+e+p++v++tYeg+H+h+
  Traes_2AS_0186B9E4F.2 315 LDDGYRWRKYGQKVVRGNPHPRSYYKCTYQGCDVKKHIERSSEEPHAVITTYEGKHTHD 373
                            59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-24148209IPR003657WRKY domain
SuperFamilySSF1182901.7E-21149209IPR003657WRKY domain
SMARTSM007741.1E-28151208IPR003657WRKY domain
PfamPF031062.6E-21152206IPR003657WRKY domain
PROSITE profilePS5081120.885152209IPR003657WRKY domain
Gene3DG3DSA:2.20.25.809.0E-35302375IPR003657WRKY domain
SuperFamilySSF1182905.36E-29308375IPR003657WRKY domain
PROSITE profilePS5081135.645310375IPR003657WRKY domain
SMARTSM007746.3E-38315374IPR003657WRKY domain
PfamPF031065.3E-25316373IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MVAPSSSILK ASRSLIDNFD VFHEQDLAQL AAQVAQKKEL REKQGAGLHH KIGPQLAFSK  60
YSILDQVDNS SSFSLATSVL TPQHVSSSVG AASMQGQTLP SHTGSGSVNT GPTGVLQVLQ  120
DSSTTLDSIN TGSAGVLEAL QGSSITLDKP ADDGYNWRKY GQKAVKGGKY PKSYYKCTLN  180
CPVRKNVEHS ADGRIIKIIY RGQHCHEPPS KRFKDCGDLL NELDEFNDAK DPSTRSQLGC  240
QGYYGKPITP NGTMVDGLLP TKEEGDEQLS SLSDIREGDG EIRTVDGDVG DADANERNAP  300
GQKIIVSTTS DVDLLDDGYR WRKYGQKVVR GNPHPRSYYK CTYQGCDVKK HIERSSEEPH  360
AVITTYEGKH THDVPESRNR SQGTGQHHCK EQTYSEQPAA SFCSSSEKRK YGTAILNDLA  420
F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-34152375878Probable WRKY transcription factor 4
2lex_A4e-34152375878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6654300.0EU665430.1 Triticum aestivum WRKY19 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010236040.10.0PREDICTED: probable WRKY transcription factor 3 isoform X2
TrEMBLW5AZ610.0W5AZ61_WHEAT; Uncharacterized protein
STRINGMLOC_5850.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP134538122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.16e-71WRKY DNA-binding protein 3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]